Adenine phosphoribosyltransferase
| Cat. Number | BioAL-000047 |
| Description | Adenine phosphoribosyltransferase is widely spread in nature, it is produced in bacteria and eukaryotes, participates in the alternative de novo synthesis of purine nucleotides. |
| Name | E.coli adenine phosphoribosyltransferase |
| Synonym | EC 2.4.2.7; APRT |
| Enzyme activity | |
| Amino acid sequence | MTATAQQLEYLKNSIKSIQDYPKPGILFRDVTSLLEDPKAYALSI DLLVERYKNAGITKVVGTEARGFLFGAPVALGLGVGFVPVRKP GKLPRETISETYDLEYGTDQLEIHVDAIKPGDKVLVVDDLLATGG TIEATVKLIRRLGGEVADAAFIINLFDLGGEQRLEKQGITSYSLVP FPGH |
| Molecular weight | 20 kDa |
| Natural Source | E. coli |
| Expression system | E. coli |
| Physical Appearance | Colourless clear liquid |
| Storage conditions | Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C. |
| Purity | > 80 % PAGE analysis of the recombinant E.coli adenine phosphoribosyltransferase |
| Usage | For Research only |
| Availability | Email: sale@alinda.ru |
| Price Category | |
| Prices, USD | |
| Supplier | Alinda Chemical Ltd. |