Desirudin (Hirudin)

Cat. Number BioAL-000021
Description Desirudinee (Hirudin) is a direct action anticoagulant decreasing the activity of thrombin in blood. Anticoagulants are used in the therapy of myocardium and lung infarct, thrombocytic and embolic insults, thrombophlebitis and others, as well as in the preventive treatment of atherosclerosis of coronary arteries, brain vessels, rheumatoid mitral valve diseases. In surgery it is used to prevent thrombus formation during the post-operative period.
Name  Desirudin (Hirudin)
Synonym 63-desulphatohirudin -1; 63-desulphohirudin -1
Amino acid sequence VVYTDCTESGQNLCLCEGSNVCGQGNKCILGSD
GEKNQCVTGEGTPKPQSHNDGDFEEIPEEYLQ
Molecular weight 6968,55 Da
Natural Source Hirudo medicinalis
Expression system E. coli
Physical Appearance Colourless clear liquid
Storage conditions Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Purity > 80 %
PAGE analysis of the PAGE analysis of the recombinant Hirudin
Usage For Research only
Availability Email: sale@alinda.ru
Price Category
Prices, USD
Supplier Alinda Chemical Ltd.