Desirudin (Hirudin)
| Cat. Number | BioAL-000021 |
| Description | Desirudinee (Hirudin) is a direct action anticoagulant decreasing the activity of thrombin in blood. Anticoagulants are used in the therapy of myocardium and lung infarct, thrombocytic and embolic insults, thrombophlebitis and others, as well as in the preventive treatment of atherosclerosis of coronary arteries, brain vessels, rheumatoid mitral valve diseases. In surgery it is used to prevent thrombus formation during the post-operative period. |
| Name | Desirudin (Hirudin) |
| Synonym | 63-desulphatohirudin -1; 63-desulphohirudin -1 |
| Amino acid sequence | VVYTDCTESGQNLCLCEGSNVCGQGNKCILGSD GEKNQCVTGEGTPKPQSHNDGDFEEIPEEYLQ |
| Molecular weight | 6968,55 Da |
| Natural Source | Hirudo medicinalis |
| Expression system | E. coli |
| Physical Appearance | Colourless clear liquid |
| Storage conditions | Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C. |
| Purity | >
80 % PAGE analysis of the PAGE analysis of the recombinant Hirudin |
| Usage | For Research only |
| Availability | Email: sale@alinda.ru |
| Price Category | |
| Prices, USD | |
| Supplier | Alinda Chemical Ltd. |