Recombinant interleukin-15 (human)
Cat. Number | BioAL-000009 |
Description | Human interleukin 15 (hIL15) is a non-specific hemopoietin stimulating the formation of cell colonies and the proliferation of mature blood cells of various types. Therefore it is used in the therapy of different deseases of hemopoietic organs. hIL15 is also able to induce the functions of auxilliary marrow cells necessary for an efficient immune response. |
Name | Recombinant interleukin-15 (human) |
Synonym | IL-15, MGC9721 |
Amino acid sequence | MNWVNVISDLKKIEDLIQSMHIDATLYTESDVHPSCKVTAMKCFLLELQV ISLESGDASIHDTVENLIILANNSLSSNGNVTESGCKECEELEEKNIKEFL QSFVHIVQMFINTS |
Molecular weight | 12903,59 Da |
Natural Source | Homo sapiens |
Expression system | E. coli |
Physical Appearance | Lyophilized
substance, white powder |
Storage conditions | Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C. |
Purity | >
98 % HPLC was carried out on Prosphere column (C18 300A 5u, Alltech) in 0.1% TFA with 10 – 80% acetonitrile gradient at flow rate 0.75 mL/min |
Usage | For Research only |
Availability | Email: sale@alinda.ru |
Price Category | |
Prices, USD | |
Supplier | Alinda Chemical Ltd. |