Recombinant mutant (Met62Val) purine nucleoside phosphorylase (E. coli)
| Cat. Number | BioAL-000041 |
| Description | These enzymes are widely used for the synthesis of modified nucleotides (virasol, cladribine, fludarabine) which are efficient antiviral and antitumor drugs. |
| Name | Recombinant mutant (Met62Val) purine nucleoside phosphorylase (E. coli) |
| Synonym | EC 2.4.2.1 |
| Enzyme activity | 27 U/mg |
| Amino acid sequence | MATPHINAEMGDFADVVLMPGDPLRAKYIAETF LEDAREVNNVRGMLGFTGTYKGRKISVMGHGM GIPSCSIYTKELITDFGVKKIIRVGSCGAVLPHVK LRDVVIGMGACTDSKVNRIRFKDHDFAAIADFD MVRNAVDAAKALGIDARVGNLFSADLFYSPDGE MFDVMEKYGILGVEMEAAGIYGVAAEFGAKALTI CTVSDHIRTHEQTTAAERQTTFNDMIKIALESVLLG DKE |
| Molecular weight | 156 kDa |
| Natural Source | E. coli |
| Expression system | E. coli |
| Physical Appearance | Colourless clear liquid |
| Storage conditions | Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C. |
| Purity | >
95 % |
| Usage | For Research only |
| Availability | Email: sale@alinda.ru |
| Price Category | |
| Prices, USD | |
| Supplier | Alinda Chemical Ltd. |