Phosphoribosylpyrophosphate synthetase E. coli
| Cat. Number | BioAL-000058 |
| Description | Phosphoribosylpyrophosphate (PRPP) synthetase participates in the biosynthesis in bacteria of purine nucleotides, pyrimidine nucleotides, tryptophan, histidine, and the pyridine nucleotide coenzymes. |
| Name | Phosphoribosylpyrophosphate synthetase E. coli |
| Synonym | PRPP synthetase |
| Enzyme activity | |
| Amino acid sequence | MАPDMKLFAGNATPELAQRIANRLYTSLGD AAVGRFSDGEVSVQINENVRGGDIFIIQSTC APTNDNLMELVVMVDALRRASAGRITAVI PYFGYARQDRRVRSARVPITAKVVADFLSS VGVDRVLTVDLHAEQIQGFFDVPVDNVFG SPILLEDMLQLNLDNPIVVSPDIGGVVRAR AIAKLLNDTDMAIIDKRRPRANVSQVMHII GDVAGRDCVLVDDMIDTGGTLCKAAEAL KERGAKRVFAYATHPIFSGNAANNLRNS VIDEVVVCDTIPLSDEIKSLPNVRTLTLSGM LAEAIRRISNEESISAMFEH |
| Molecular weight | 34 kDa |
| Natural Source | E. coli |
| Expression system | E. coli |
| Physical Appearance | Colourless clear liquid |
| Storage conditions | Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C. |
| Purity | >
80 % PAGE analysis of the Recombinant Phosphoribosylpyrophosphate synthetase E. coli |
| Usage | For Research only |
| Availability | Email: sale@alinda.ru |
| Price Category | |
| Prices, USD | |
| Supplier | Alinda Chemical Ltd. |